| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 4-c-12-b-25-c-20 | 19-b-36 |
Chain Sequence |
KKKCIAKDYGRCKWGGTPCCRGRGCICSIMGTNCECKPRLIMEGLGLA
|
| sequence length |
48
|
| structure length |
48
|
| publication title |
Structure-activity relationships for P-type calcium channel-selective omega-agatoxins.
pubmed doi rcsb |
| molecule tags |
Neurotoxin
|
| molecule keywords |
OMEGA-AGATOXIN-IVA
|
| source organism |
Agelenopsis aperta
|
| ec nomenclature | |
| pdb deposition date | 1994-10-27 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Omega-AgatoxinV | Omega-AgatoxinV |
#chains in the KnotProt database with same CATH superfamily 1IVA A; 1AGG A; 1OAV A; 1OAW A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A; #chains in the KnotProt database with same CATH topology 1IVA A; 2DCW A; 1CIX A; 1AGG A; 1OAV A; 1OAW A; 2DCV A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A; #chains in the KnotProt database with same CATH homology 1IVA A; 2DCW A; 1CIX A; 1AGG A; 1OAV A; 1OAW A; 2DCV A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
