| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 12-69 | 58 | 1-11 | 156-159 | 70-155 | 11 | 4 | slipknot |
Chain Sequence |
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVNLIRISAIMPPEAEIVPLPKLPMGALVPTAYGYIISDVPGETISAAISVAIPKDKSLCGLIMEYEGKCSKKEAEKTVREMAKIGFEMRGWELDRIESIAVEHTVEKLGCAFAAAALWYK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 12-71 | 60 | 1-11 | 153-159 | 72-152 | 11 | 7 | slipknot | ||
| view details |
|
3.1 | 14-71 | 58 | 1-11, 149-159 | 12-13, 72-148 | 11 | 11 | slipknot | |||
| view details |
 |
2.1 | 15-78 | 64 | 1-13, 148-159 | 14-14, 79-147 | 13 | 12 | slipknot |
| sequence length |
159
|
| structure length |
159
|
| publication title |
Pyruvoyl-Dependent Arginine Decarboxylase from Methanococcus jannaschii:
Crystal Structures of the Self-Cleaved and S53A Proenzyme Forms
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Pyruvoyl-dependent arginine decarboxylase
|
| source organism |
Methanocaldococcus jannaschii
|
| total genus |
 Genus: 40
|
| ec nomenclature |
ec
4.1.1.19: Arginine decarboxylase. |
| pdb deposition date | 2002-10-23 |
| KnotProt deposition date | 2014-10-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01862 | PvlArgDC | Pyruvoyl-dependent arginine decarboxylase (PvlArgDC) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(bba) Sandwich | Pyruvoyl-Dependent Histidine Decarboxylase; Chain B | Pyruvoyl-Dependent Histidine Decarboxylase, subunit B |
#chains in the KnotProt database with same CATH superfamily 2QQD C; 1N2M A; #chains in the KnotProt database with same CATH topology 2QQD C; 1N2M A; #chains in the KnotProt database with same CATH homology 2QQD C; 1N2M A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
