Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 4-c-12-b-25-c-20 | 19-b-36 |
Chain Sequence |
EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA
|
sequence length |
48
|
structure length |
48
|
publication title |
Sequential assignment and structure determination of spider toxin omega-Aga-IVB.
pubmed doi rcsb |
molecule tags |
Toxin
|
molecule keywords |
OMEGA-AGA-IVB
|
source organism |
Agelenopsis aperta
|
ec nomenclature | |
pdb deposition date | 1993-09-09 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Omega-AgatoxinV | Omega-AgatoxinV |
#chains in the KnotProt database with same CATH superfamily 1VTX A; 1G9P A; 1OMB A; 2ROO A; 1IVA A; 1OAV A; 1AGG A; 1OAW A; 1OMA A; 1QDP A; #chains in the KnotProt database with same CATH topology 1VTX A; 1G9P A; 1OMB A; 2ROO A; 1IVA A; 2DCV A; 1CIX A; 1OAV A; 2DCW A; 1AGG A; 1OAW A; 1OMA A; 1QDP A; #chains in the KnotProt database with same CATH homology 1VTX A; 1G9P A; 1OMB A; 2ROO A; 1IVA A; 2DCV A; 1CIX A; 1OAV A; 2DCW A; 1AGG A; 1OAW A; 1OMA A; 1QDP A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...