1SUVC

Structure of human transferrin receptor-transferrin complex
Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!
Knot K 2x +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
+ 31 19-160 142 1-18, 161-220 18 59 slipknot
Fingerprint Knot forming loop Loop type
K +31 Asp63 <->
Bridging ionFe339
<-> Tyr188 ... Cys331 <-> Cys137 ... Asp63
ion-based
K +31 Asp63 <->
Bridging ionFe339
<-> Tyr188 ... Cys227 <-> Cys241 ... Cys331 <-> Cys137 ... Asp63
ion-based
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
sequence length 329
structure length 329
publication title Structure of the Human Transferrin Receptor-Transferrin Complex
pubmed doi rcsb
molecule tags Metal transport
molecule keywords Transferrin receptor protein 1
source organism Homo sapiens
total genus Genus: 107
ec nomenclature
pdb deposition date 2004-03-26
KnotProt deposition date 2018-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling