1SUV | KnotProt

Note, that the numbers in the matrix denote the consecutive residues in the loop, not the index of amino acids in the chain!

Knot K 2x +3₁

loadScript /static/js/j2s/core/package.js

loadScript /static/js/j2s/core/corejmol.z.js

loadScript /static/js/j2s/core/corescript.z.js

JSmol exec jmolApplet2 start applet null

Jmol JavaScript applet jmolApplet2__293892370358173__ initializing

Jmol getValue debug null

Jmol getValue logLevel null

Jmol getValue allowjavascript null

AppletRegistry.checkIn(jmolApplet2__293892370358173__)

vwrOptions:

{ "name":"jmolApplet2","applet":true,"documentBase":"https://knotprot.cent.uw.edu.pl/view/1SUV/C/","platform":"J.awtjs2d.Platform","fullName":"jmolApplet2__293892370358173__","codePath":"https:/static/js/j2s/","display":"jmolApplet2_canvas2d","signedApplet":"true","appletReadyCallback":"Jmol._readyCallback","statusListener":"[J.appletjs.Jmol object]","syncId":"293892370358173","bgcolor":"white" }

setting document base to "https://knotprot.cent.uw.edu.pl/view/1SUV/C/"

Jmol Version: 14.29.13 2018-04-17 17:17

java.vendor: Java2Script (HTML5)

java.version: 2018-01-28 23:38:52 (JSmol/j2s)

os.name: Mozilla/5.0 AppleWebKit/537.36 (KHTML, like Gecko; compatible; ClaudeBot/1.0; +claudebot@anthropic.com)

Access: ALL

memory: 0.0/0.0

processors available: 1

useCommandThread: false

appletId:jmolApplet2 (signed)

Jmol getValue emulate null

defaults = "Jmol"

Jmol getValue boxbgcolor null

Jmol getValue bgcolor white

backgroundColor = "white"

Jmol getValue ANIMFRAMECallback null

Jmol getValue APPLETREADYCallback Jmol._readyCallback

APPLETREADYCallback = "Jmol._readyCallback"

callback set for APPLETREADYCallback Jmol._readyCallback APPLETREADY

Jmol getValue ATOMMOVEDCallback null

Jmol getValue AUDIOCallback null

Jmol getValue CLICKCallback null

Jmol getValue DRAGDROPCallback null

Jmol getValue ECHOCallback null

Jmol getValue ERRORCallback null

Jmol getValue EVALCallback null

Jmol getValue HOVERCallback null

Jmol getValue IMAGECallback null

Jmol getValue LOADSTRUCTCallback null

Jmol getValue MEASURECallback null

Jmol getValue MESSAGECallback null

Jmol getValue MINIMIZATIONCallback null

Jmol getValue SERVICECallback null

Jmol getValue PICKCallback null

Jmol getValue RESIZECallback null

Jmol getValue SCRIPTCallback null

Jmol getValue SYNCCallback null

Jmol getValue STRUCTUREMODIFIEDCallback null

Jmol getValue doTranslate null

language=en_US

Jmol getValue popupMenu null

Jmol getValue script null

Jmol getValue loadInline null

Jmol getValue load null

Jmol applet jmolApplet2__293892370358173__ ready

script 1 started

platformSpeed = 8

Help Knotting data interpretation Full screen

				Knot core range	Knot core length	Knot tails range	Slipknot tails range	Slipknot loops range	N-end length	C-end length	Type
view details			+ 3₁	19-160	142	1-18, 161-220			18	59	slipknot
view details			+ 3₁	19-159	141	1-18, 160-207			18	47	slipknot

			Fingerprint	Knot forming loop	Loop type
knots details			K +3₁	Asp63 <-> Bridging ionFe339 <-> Tyr188 ... Cys331 <-> Cys137 ... Asp63	ion-based	color sequence
knots details			K +3₁	Asp63 <-> Bridging ionFe339 <-> Tyr188 ... Cys227 <-> Cys241 ... Cys331 <-> Cys137 ... Asp63	ion-based	color sequence

Chain Sequence

DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC

sequence length	329
structure length	329
publication title	Structure of the Human Transferrin Receptor-Transferrin Complex pubmed doi rcsb
molecule tags	Metal transport
molecule keywords	Transferrin receptor protein 1
source organism	Homo sapiens
total genus	Genus: 107
ec nomenclature
pdb deposition date	2004-03-26
KnotProt deposition date	2018-10-31

pfam database annotations

chain	Pfam Accession Code	Pfam Family Identifier	Pfam Description
C	PF00405	Transferrin	Transferrin

Image from the rcsb pdb (www.rcsb.org)

...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

1SUVC

Knot K 2x +31

Chain Sequence

pfam database annotations

Knot K 2x +3₁