| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | ||||
|---|---|---|---|---|---|---|---|---|---|---|---|
 |
+ 31 | 19-160 | 142 | 1-18, 161-220 | 18 | 59 | slipknot |
| Fingerprint | Knot forming loop | Loop type | ||||
|---|---|---|---|---|---|---|
|
|
K +31 | Asp63 <-> Bridging ionFe339 <-> Tyr188 ... Cys331 <-> Cys137 ... Asp63 |
ion-based | |||
|
|
K +31 | Asp63 <-> Bridging ionFe339 <-> Tyr188 ... Cys227 <-> Cys241 ... Cys331 <-> Cys137 ... Asp63 |
ion-based |
Chain Sequence |
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
|
| sequence length |
329
|
| structure length |
329
|
| publication title |
Structure of the Human Transferrin Receptor-Transferrin Complex
pubmed doi rcsb |
| molecule tags |
Metal transport
|
| molecule keywords |
Transferrin receptor protein 1
|
| source organism |
Homo sapiens
|
| total genus |
 Genus: 107
|
| ec nomenclature | |
| pdb deposition date | 2004-03-26 |
| KnotProt deposition date | 2018-10-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF00405 | Transferrin | Transferrin |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
