| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 93-c-100-b-114-c-108 | 107-b-125 |
Chain Sequence |
CVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC
|
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Agouti Related Protein; Chain A | Agouti Related Protein; Chain A |
#chains in the KnotProt database with same CATH superfamily 1Y7J A; 2KZA A; 1Y7K A; #chains in the KnotProt database with same CATH topology 1Y7J A; 2KZA A; 1Y7K A; #chains in the KnotProt database with same CATH homology 1Y7J A; 2KZA A; 1Y7K A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...