1AXHA

Atracotoxin-hvi from hadronyche versuta (australian funnel-web spider, nmr, 20 structures
Cysteine knot
Loop Piercing
view details
4-c-11-b-22-c-18 17-b-36
Chain Sequence
SPTCIPSGQPCPYNENCCSQSCTFKENENGNTVKRCD
sequence length 37
structure length 37
publication title The structure of a novel insecticidal neurotoxin, omega-atracotoxin-HV1, from the venom of an Australian funnel web spider.
pubmed doi rcsb
molecule tags Neurotoxin
molecule keywords ATRACOTOXIN-HVI
source organism Hadronyche versuta
ec nomenclature
pdb deposition date 1996-11-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling