1C4EA

Gurmarin from gymnema sylvestre
Cysteine knot
Loop Piercing
view details
3-c-10-b-23-c-18 17-b-33
Chain Sequence
EQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG
sequence length 35
structure length 35
publication title High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide.
pubmed doi rcsb
molecule tags Plant protein
molecule keywords PROTEIN (GURMARIN)
ec nomenclature
pdb deposition date 1999-07-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling