1CHLA

Nmr sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels
Cysteine knot
Loop Piercing
view details
2-c-5-b-28-c-19 16-b-33
Chain Sequence
MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR
sequence length 36
structure length 36
publication title NMR sequential assignments and solution structure of chlorotoxin, a small scorpion toxin that blocks chloride channels.
pubmed doi rcsb
molecule tags Neurotoxin
molecule keywords CHLOROTOXIN
source organism Leiurus quinquestriatus
ec nomenclature
pdb deposition date 1994-11-09
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling