Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 4-c-11-b-29-c-24 | 23-b-41 |
Chain Sequence |
YSRCQLQGFNCVVRSYGLPTIPCCRGLTCRSYFPGSTYGRCQRY
|
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Omega-AgatoxinV | Omega-AgatoxinV |
#chains in the KnotProt database with same CATH superfamily 2DCV A; 2DCW A; 1CIX A; #chains in the KnotProt database with same CATH topology 1IVA A; 2DCW A; 1CIX A; 1AGG A; 1OAV A; 1OAW A; 2DCV A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A; #chains in the KnotProt database with same CATH homology 1IVA A; 2DCW A; 1CIX A; 1AGG A; 1OAV A; 1OAW A; 2DCV A; 1QDP A; 2ROO A; 1G9P A; 1OMB A; 1VTX A; 1OMA A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...