1CLVI

Yellow meal worm alpha-amylase in complex with the amaranth alpha-amylase inhibitor
Cysteine knot
Loop Piercing
view details
501-c-508-b-523-c-518 517-b-531
Chain Sequence
CIPKWNRCGPKMDGVPCCEPYTCTSDYYGNCS
sequence length 32
structure length 32
publication title Specific inhibition of insect alpha-amylases: yellow meal worm alpha-amylase in complex with the amaranth alpha-amylase inhibitor at 2.0 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PROTEIN (ALPHA-AMYLASE)
ec nomenclature
pdb deposition date 1999-05-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling