1DKCA

Solution structure of pafp-s, an antifungal peptide from the seeds of phytolacca americana
Cysteine knot
Loop Piercing
view details
3-c-10-b-24-c-20 19-b-35
Chain Sequence
AGCIKNGGRCNASAGPPYCCSSYCFQIAGQSYGVCKNR
sequence length 38
structure length 38
publication title Solution structure of PAFP-S: a new knottin-type antifungal peptide from the seeds of Phytolacca americana
pubmed doi rcsb
molecule tags Antifungal protein
molecule keywords ANTIFUNGAL PEPTIDE
ec nomenclature
pdb deposition date 1999-12-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling