1EITA

Nmr study of mu-agatoxin
Cysteine knot
Loop Piercing
view details
2-c-9-b-22-c-17 16-b-32
Chain Sequence
ECVPENGHCRDWYDECCEGFYCSCRQPPKCICRNNN
sequence length 36
structure length 36
publication title Three-dimensional structure analysis of mu-agatoxins: further evidence for common motifs among neurotoxins with diverse ion channel specificities.
pubmed doi rcsb
molecule tags Neurotoxin
molecule keywords MU-AGATOXIN-I
ec nomenclature
pdb deposition date 1995-12-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling