| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
-31 | 381-460 | 80 | 1-380 | 488-490 | 461-487 | 380 | 3 | slipknot |
Chain Sequence |
TVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIH
|
Knotoid cutoff: 0.5


Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
|
2.1m | 387-482 | 96 | 1-386, 483-490 | 386 | 8 | knot | ||||
| view details |
|
2.1m | 387-457 | 71 | 1-386 | 468-490 | 458-467 | 386 | 23 | slipknot |
| sequence length |
490
|
| structure length |
490
|
| publication title |
The Crystal Structure of the Mouse Apoptosis-Inducing Factor Aif
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| molecule keywords |
PROGRAMED CELL DEATH PROTEIN 8
|
| source organism |
Mus musculus
|
| total genus |
Genus: 149
|
| ec nomenclature | |
| pdb deposition date | 2002-02-05 |
| KnotProt deposition date | 2014-07-31 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00070 | Pyr_redox | Pyridine nucleotide-disulphide oxidoreductase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Enolase-like; domain 1 | Enolase-like; domain 1 | ||
| Alpha Beta | 3-Layer(bba) Sandwich | FAD/NAD(P)-binding domain | FAD/NAD(P)-binding domain | ||
| Alpha Beta | 3-Layer(bba) Sandwich | FAD/NAD(P)-binding domain | FAD/NAD(P)-binding domain |
#chains in the KnotProt database with same CATH superfamily 1GV4 A; #chains in the KnotProt database with same CATH topology 1GV4 A; #chains in the KnotProt database with same CATH homology 1GV4 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...