1H20A

Solution structure of the potato carboxypeptidase inhibitor
Cysteine knot
Loop Piercing
view details
8-c-12-b-27-c-24 18-b-34
Chain Sequence
EQHADPICNKPCKTHDDCSGAWFCQACWNSARTCGPYVG
sequence length 39
structure length 39
publication title Structure and Dynamics of the Potato Carboxypeptidase Inhibitor by 1H and 15N NMR.
pubmed doi rcsb
molecule tags Inhibitor
molecule keywords METALLOCARBOXYPEPTIDASE INHIBITOR
source organism Solanum tuberosum
ec nomenclature
pdb deposition date 2002-07-29
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling