1I26A

Solution structure of ptu-1, a toxin from the assassin bugs peirates turpis that blocks the voltage sensitive calcium channel n-type
Cysteine knot
Loop Piercing
view details
5-c-12-b-26-c-20 19-b-33
Chain Sequence
AEKDCIAPGAPCFGTDKPCCNPRAWCSSYANKCL
sequence length 34
structure length 34
publication title Solution structure of Ptu1, a toxin from the assassin bug Peirates turpis that blocks the voltage-sensitive calcium channel N-type.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PTU-1
ec nomenclature
pdb deposition date 2001-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling