| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-21-c-16 | 15-b-30 |
Chain Sequence |
DCVRFWGKCSQTSDCCPHLACKSKWPRNICVWDGSV
|
| sequence length |
36
|
| structure length |
36
|
| publication title |
Solution structure of omega-grammotoxin SIA, a gating modifier of P/Q and N-type Ca(2+) channel.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Voltage-dependent Channel Inhibitor
|
| ec nomenclature | |
| pdb deposition date | 2001-12-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
