1KQIA

Nmr solution structure of the trans pro30 isomer of actx-hi:ob4219
Cysteine knot
Loop Piercing
view details
2-c-9-b-23-c-18 17-b-33
Chain Sequence
KCLAEAADCSPWSGDSCCKPYLCSCIFFYPCSCRPKGW
sequence length 38
structure length 38
publication title Solution structures of the cis- and trans-Pro30 isomers of a novel 38-residue toxin from the venom of Hadronyche Infensa sp. that contains a cystine-knot motif within its four disulfide bonds
pubmed doi rcsb
molecule tags Toxin
molecule keywords ACTX-Hi:OB4219
ec nomenclature
pdb deposition date 2002-01-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling