1LMRA

Solution of ado1, a toxin from the assassin bugs agriosphodrus dohrni that blocks the voltage sensitive calcium channel l-type
Cysteine knot
Loop Piercing
view details
5-c-12-b-25-c-20 19-b-32
Chain Sequence
ADDDCLPRGSKCLGENKQCCKGTTCMFYANRCVGV
sequence length 35
structure length 35
publication title Solution structure of ADO1, a toxin extracted from the saliva of the assassin bug, Agriosphodrus dohrni
pubmed doi rcsb
molecule tags Toxin
molecule keywords TOXIN ADO1
ec nomenclature
pdb deposition date 2002-05-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling