1LUPA

Solution structure of a toxin (gsmtx2) from the tarantula, grammostola spatulata, which inhibits mechanosensitive ion channels
Cysteine knot

  Help Cysteine knot data interpretation Full screen
Loop Piercing
view details
2-c-9-b-21-c-16 15-b-25
Chain Sequence
YCQKWMWTCDEERKCCEGLVCRLWCKRIINM
sequence length 31
structure length 31
publication title Solution structure of peptide toxins that block mechanosensitive ion channels
pubmed doi rcsb
molecule tags Toxin
molecule keywords GsMTx2
ec nomenclature
pdb deposition date 2002-05-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

  
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling