Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 7-c-14-b-34-c-23 | 20-b-41 |
Chain Sequence |
ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC
|
sequence length |
47
|
structure length |
47
|
publication title |
Structure of Petunia hybrida defensin 1, a novel plant defensin with five disulfide bonds
pubmed doi rcsb |
molecule tags |
Plant protein
|
molecule keywords |
floral defensin-like protein 1
|
ec nomenclature | |
pdb deposition date | 2002-11-01 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Defensin A-like | Defensin A-like |
#chains in the KnotProt database with same CATH superfamily 2KBK A; 1N4N A; 1NH5 A; 1PX9 A; 2KBH A; #chains in the KnotProt database with same CATH topology 2KBK A; 1N4N A; 1NH5 A; 1PX9 A; 2KBH A; #chains in the KnotProt database with same CATH homology 2KBK A; 1N4N A; 1NH5 A; 1PX9 A; 2KBH A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...