Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 15-c-21-b-40-c-35 | 25-b-40 |
Chain Sequence |
KDGYPVDSKGCKLSCVANNYCDNQCKMKKASGGHCYAMSCYCEGLPENAKVSDSATNICG
|
sequence length |
60
|
structure length |
60
|
publication title |
Automatic assignment of NOESY Cross peaks and determination of the protein structure of a new world scorpion neurotoxin Using NOAH/DIAMOD
pubmed doi rcsb |
molecule tags |
Toxin
|
molecule keywords |
Neurotoxin 5
|
ec nomenclature | |
pdb deposition date | 2002-12-18 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Defensin A-like | Defensin A-like |
#chains in the KnotProt database with same CATH superfamily 2KBH A; 1N4N A; 2KBK A; 1NH5 A; 1PX9 A; #chains in the KnotProt database with same CATH topology 2KBH A; 1N4N A; 2KBK A; 1NH5 A; 1PX9 A; #chains in the KnotProt database with same CATH homology 2KBH A; 1N4N A; 2KBK A; 1NH5 A; 1PX9 A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...