| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 143-c-146-b-204-c-204 | 143-b-201 |
Chain Sequence |
PQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKDPE
|
| sequence length |
228
|
| structure length |
228
|
| publication title |
The crystal structure of the yeast Hsp40 Ydj1 complexed with its peptide substrate.
pubmed doi rcsb |
| molecule tags |
Protein transport
|
| molecule keywords |
Mitochondrial protein import protein MAS5
|
| source organism |
Saccharomyces cerevisiae
|
| ec nomenclature | |
| pdb deposition date | 2003-01-07 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Ribbon | Chaperone, DNAj Protein; Chain A | Chaperone, DNAj Protein; Chain | ||
| Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | Urease metallochaperone UreE, N-terminal domain | ||
| Mainly Beta | Sandwich | HSP40/DNAj peptide-binding domain | Urease metallochaperone UreE, N-terminal domain |
#chains in the KnotProt database with same CATH superfamily 1NLT A; #chains in the KnotProt database with same CATH topology 1NLT A; #chains in the KnotProt database with same CATH homology 1NLT A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
