| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-7-b-22-c-20 | 15-b-32 |
Chain Sequence |
ASCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSG
|
| sequence length |
37
|
| structure length |
37
|
| publication title |
PA1b, an insecticidal protein extracted from pea seeds (Pisum sativum): 1H-2-D NMR study and molecular modeling
pubmed doi rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Pea Albumin 1, subunit b
|
| ec nomenclature | |
| pdb deposition date | 2003-05-06 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
