| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 5-c-11-b-34-c-23 | 20-b-39 |
Chain Sequence |
DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA
|
| sequence length |
42
|
| structure length |
42
|
| publication title |
Exploring structural features of the interaction between the scorpion toxinCnErg1 and ERG K+ channels.
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
ergtoxin
|
| ec nomenclature | |
| pdb deposition date | 2003-07-03 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Defensin A-like | Defensin A-like |
#chains in the KnotProt database with same CATH superfamily 1NH5 A; 1N4N A; 1PX9 A; 2KBH A; 2KBK A; #chains in the KnotProt database with same CATH topology 1NH5 A; 1N4N A; 1PX9 A; 2KBH A; 2KBK A; #chains in the KnotProt database with same CATH homology 1NH5 A; 1N4N A; 1PX9 A; 2KBH A; 2KBK A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...