| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-8-b-22-c-18 | 17-b-33 |
Chain Sequence |
CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
|
| sequence length |
36
|
| structure length |
36
|
| publication title |
Solution structure of Alo-3: a new knottin-type antifungal peptide from the insect Acrocinus longimanus.
pubmed doi rcsb |
| molecule tags |
Antifungal protein
|
| molecule keywords |
ALO3
|
| ec nomenclature | |
| pdb deposition date | 2003-07-30 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
