1QK6A

Solution structure of huwentoxin-i by nmr
Cysteine knot
Loop Piercing
view details
2-c-9-b-22-c-17 16-b-29
Chain Sequence
ACKGVFDACTPGKNECCPNRVCSDKHKWCKWKL
sequence length 33
structure length 33
publication title Proton Nuclear Magnetic Resonance Studies on Huwentoxin-I from the Venom of the Spider Selenocosmia Huwena:2.Three-Dimensional Structure in Solution
pubmed doi rcsb
molecule tags Toxin
molecule keywords HUWENTOXIN-I
ec nomenclature
pdb deposition date 1999-07-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling