| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 3-c-7-b-23-c-21 | 13-b-31 |
Chain Sequence |
TFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRNGDP
|
| sequence length |
37
|
| structure length |
37
|
| publication title |
Solution structure of the cyclotide palicourein: implications for the development of a pharmaceutical framework.
pubmed doi rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Palicourein
|
| ec nomenclature | |
| pdb deposition date | 2003-09-23 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
