| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-25-c-20 | 19-b-30 |
Chain Sequence |
ACSKKWEYCIVPILGFVYCCPGLICGPFVCV
|
| sequence length |
31
|
| structure length |
31
|
| publication title |
Structures of muO-conotoxins from Conus marmoreus. Inhibitors of tetrodotoxin (TTX)-sensitive and TTX-resistant sodium channels in mammalian sensory neurons
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Mu-O-conotoxin MrVIB
|
| ec nomenclature | |
| pdb deposition date | 2003-11-28 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
