1RYVA

Three dimensional solution structure of the k27a mutant of sodium channels inhibitor hainantoxin-iv by 2d 1h-nmr
Cysteine knot
Loop Piercing
view details
2-c-9-b-24-c-17 16-b-31
Chain Sequence
ECLGFGKGCNPSNDQCCKSSNLVCSRAHRWCKYEI
sequence length 35
structure length 35
publication title Structure--activity relationships of hainantoxin-IV and structure determination of active and inactive sodium channel blockers
pubmed doi rcsb
molecule tags Toxin
molecule keywords Hainantoxin-IV
ec nomenclature
pdb deposition date 2003-12-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling