| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 21-c-25-b-39-c-32 | 19-b-31 |
Chain Sequence |
DQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTM
|
| sequence length |
51
|
| structure length |
51
|
| publication title |
The solution structure of the N-terminal domain of human vitronectin: proximal sites that regulate fibrinolysis and cell migration
pubmed doi rcsb |
| molecule tags |
Cell adhesion
|
| molecule keywords |
Vitronectin
|
| ec nomenclature | |
| pdb deposition date | 2004-01-16 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
