1S6XA

Solution structure of vstx
Cysteine knot
Loop Piercing
view details
2-c-9-b-21-c-16 15-b-28
Chain Sequence
ECGKFMWKCKNSNDCCKDLVCSSRWKWCVLASPF
sequence length 34
structure length 34
publication title Solution structure and lipid membrane partitioning of VSTx1, an inhibitor of the KvAP potassium channel.
pubmed doi rcsb
molecule tags Toxin
molecule keywords KvAP CHANNEL
ec nomenclature
pdb deposition date 2004-01-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling