| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 10-c-29-b-32-c-32 | 7-b-32 |
Chain Sequence |
MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQF
|
| sequence length |
121
|
| structure length |
121
|
| publication title |
Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb |
| molecule tags |
Transcription
|
| molecule keywords |
DNA-directed RNA polymerase II largest subunit
|
| ec nomenclature | |
| pdb deposition date | 2004-06-30 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Single Sheet | N-terminal domain of TfIIb | N-terminal domain of TfIIb | ||
| Mainly Beta | Single Sheet | N-terminal domain of TfIIb | N-terminal domain of TfIIb |
#chains in the KnotProt database with same CATH superfamily 1TWG I; 1TWH I; #chains in the KnotProt database with same CATH topology 1TWG I; 1TWH I; #chains in the KnotProt database with same CATH homology 1TWG I; 1TWH I;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
