| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 2-c-9-b-23-c-18 | 17-b-33 |
Chain Sequence |
ACVGDGQRCASWSGPYCCDGYYCSCRSMPYCRCRNNS
|
| sequence length |
37
|
| structure length |
37
|
| publication title |
Solution structure of two insect-specific spider toxins and their pharmacological interaction with the insect voltage-gated Na(+) channel
pubmed doi rcsb |
| molecule tags |
Toxin
|
| molecule keywords |
Delta-palutoxin IT2
|
| ec nomenclature | |
| pdb deposition date | 2004-01-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
