| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-5-b-20-c-18 | 10-b-25 |
Chain Sequence |
CAESCVWIPCTVTALLGCSCSNKVCYNGIP
|
| sequence length |
30
|
| structure length |
30
|
| publication title |
Tissue-specific expression of head-to-tail cyclized miniproteins in Violaceae and structure determination of the root cyclotide Viola hederacea root cyclotide1
pubmed doi rcsb |
| molecule tags |
Plant protein
|
| molecule keywords |
Viola hederacea root peptide 1
|
| ec nomenclature | |
| pdb deposition date | 2004-02-25 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
