| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-8-b-20-c-15 | 14-b-31 |
Chain Sequence |
CAKKRNWCGKTEDCCCPMKCVYAWYNEQGSCQSTISALWKKC
|
| sequence length |
42
|
| structure length |
42
|
| publication title |
The structure of versutoxin (delta-atracotoxin-Hv1) provides insights into the binding of site 3 neurotoxins to the voltage-gated sodium channel.
pubmed doi rcsb |
| molecule tags |
Neurotoxin
|
| molecule keywords |
DELTA-ATRACOTOXIN-HV1
|
| ec nomenclature | |
| pdb deposition date | 1997-03-13 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Omega-AgatoxinV | Omega-AgatoxinV |
#chains in the KnotProt database with same CATH superfamily 1OMB A; 2ROO A; 1OMA A; 1VTX A; 1OAV A; 1OAW A; 1IVA A; 1AGG A; 1QDP A; 1G9P A; #chains in the KnotProt database with same CATH topology 1OMB A; 2ROO A; 1OMA A; 1VTX A; 2DCV A; 1CIX A; 1OAV A; 1OAW A; 2DCW A; 1IVA A; 1AGG A; 1QDP A; 1G9P A; #chains in the KnotProt database with same CATH homology 1OMB A; 2ROO A; 1OMA A; 1VTX A; 2DCV A; 1CIX A; 1OAV A; 1OAW A; 2DCW A; 1IVA A; 1AGG A; 1QDP A; 1G9P A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...