1WWLA

Crystal structure of cd14
Cysteine knot
Loop Piercing
view details
8-c-15-b-32-c-17 17-b-32
Chain Sequence
PCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSE
sequence length 308
structure length 308
publication title Crystal Structure of CD14 and Its Implications for Lipopolysaccharide Signaling
pubmed doi rcsb
molecule tags Immune system
molecule keywords Monocyte differentiation antigen CD14
source organism Mus musculus
ec nomenclature
pdb deposition date 2005-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 1wwlA00
1WWLA
chains in the KnotProt database with same CATH superfamily
1WWLA
chains in the KnotProt database with same CATH topology
1WWLA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 1WWL A; 
#chains in the KnotProt database with same CATH topology
 1WWL A; 
#chains in the KnotProt database with same CATH homology
 1WWL A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.