1X5VA

Nmr structure of pcfk1
Cysteine knot
Loop Piercing
view details
2-c-9-b-24-c-19 18-b-29
Chain Sequence
ACGILHDNCVYVPAQNPCCRGLQCRYGKCLVQV
sequence length 33
structure length 33
publication title Solution structure of PcFK1, a spider peptide active against Plasmodium falciparum
pubmed doi rcsb
molecule tags Toxin
molecule keywords PcFK1
source organism Psalmopoeus cambridgei
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling