| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 7-c-14-b-39-c-22 | 21-b-47 |
Chain Sequence |
TCIGHYQKCVNADKPCCSKTVRYGDSKNVRKFICDRDGEGVCVPFDG
|
| sequence length |
47
|
| structure length |
47
|
| publication title |
Solution structure of the carboxyl-terminal cysteine-rich domain of the VHv1.1 polydnaviral gene product: comparison with other cystine knot structural folds
pubmed doi rcsb |
| molecule tags |
Viral protein
|
| molecule keywords |
cysteine-rich omega-conotoxin homolog VHv1.1
|
| source organism |
Campoletis sonorensis ichnovirus
|
| ec nomenclature | |
| pdb deposition date | 2004-09-21 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
