1XJ1A

3d solution structure of the c-terminal cysteine-rich domain of the vhv1.1 polydnaviral gene product
Cysteine knot
Loop Piercing
view details
7-c-14-b-39-c-22 21-b-47
Chain Sequence
TCIGHYQKCVNADKPCCSKTVRYGDSKNVRKFICDRDGEGVCVPFDG
sequence length 47
structure length 47
publication title Solution structure of the carboxyl-terminal cysteine-rich domain of the VHv1.1 polydnaviral gene product: comparison with other cystine knot structural folds
pubmed doi rcsb
molecule tags Viral protein
molecule keywords cysteine-rich omega-conotoxin homolog VHv1.1
source organism Campoletis sonorensis ichnovirus
ec nomenclature
pdb deposition date 2004-09-22
Image from the rcsb pdb (www.rcsb.org)
1XJ1A
similar chains in the KnotProt database (40% sequence similarity)
None
similar chains in the pdb database (40% sequence similarity)

 
#similar chains in the KnotProt database (40% sequence similarity)
1XJ1 A; 
#similar chains, but unknotted

#similar chains in the pdb database (40% sequence similarity)


KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.