1Y7J | KnotProt

Cysteine knot

Help Cysteine knot data interpretation Full screen

				Loop	Piercing
view details				93-c-100-b-114-c-108	107-b-125

Chain Sequence

CVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC

sequence length	40
structure length	40
publication title	Structures of the agouti signaling protein. pubmed doi rcsb
molecule tags	Signaling protein
molecule keywords	Agouti Signaling Protein
ec nomenclature
pdb deposition date	2004-12-08

Image from the rcsb pdb (www.rcsb.org)

cath code	Class	Architecture	Topology	Homology	Domain
4.10.760.10	Few Secondary Structures	Irregular	Agouti Related Protein; Chain A	Agouti Related Protein; Chain A	1y7jA00

1Y7KA 2KZAA 1Y7JA
chains in the KnotProt database with same CATH superfamily

1Y7KA 2KZAA 1Y7JA
chains in the KnotProt database with same CATH topology

1Y7KA 2KZAA 1Y7JA
chains in the KnotProt database with same CATH homology

#chains in the KnotProt database with same CATH superfamily
 1Y7K A;  2KZA A;  1Y7J A; 
#chains in the KnotProt database with same CATH topology
 1Y7K A;  2KZA A;  1Y7J A; 
#chains in the KnotProt database with same CATH homology
 1Y7K A;  2KZA A;  1Y7J A;

...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)

...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...