1YC0A

Short form hgfa with first kunitz domain from hai-1
Warning
  • Chain breaks within knot 31 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
  • Chain breaks within knot 52 (displayed as a gray area on the plot and as '-' on the sequence). The broken part of the chain has been replaced by a straight segment, which may affect what knot types are detected - be careful with interpreting results.
Genus: 63
Knot K -52 -31

  Help Knotting data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
-31 9-163 155 1-8, 164-254 8 91 knot
view details
-52 9-212 204 1-8 220-254 213-219 8 35 slipknot
Chain Sequence
ACGRRHKK-------IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDWINDRIR
Whole chain analysis

  Help Knotoid data interpretation Full screen
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1


  Help Knotoid subchains data interpretation Full screen
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1m 9-158 150 1-8 198-247 159-197 8 50 slipknot
view details
4.2 9-197 189 1-8 206-247 198-205 8 42 slipknot
view details
5.2m 9-205 197 1-8 212-247 206-211 8 36 slipknot
view details
3.1m 9-213 205 1-8 236-247 214-235 8 12 slipknot
view details
3.1m 9-239 231 240-247 1-3 4-8 3 7 slipknot
How to cite
KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling