| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 1-c-5-b-20-c-18 | 11-b-25 |
Chain Sequence |
CGESCAMISFCFTEVIGCSCKNKVCYLNSIS
|
| sequence length |
31
|
| structure length |
31
|
| publication title |
Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide.
pubmed doi rcsb |
| molecule tags |
Antiviral protein
|
| molecule keywords |
vhl-1
|
| ec nomenclature | |
| pdb deposition date | 2005-04-05 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
