1ZA8A

Nmr solution structure of a leaf-specific-expressed cyclotide vhl-1
Cysteine knot
Loop Piercing
view details
1-c-5-b-20-c-18 11-b-25
Chain Sequence
CGESCAMISFCFTEVIGCSCKNKVCYLNSIS
sequence length 31
structure length 31
publication title Isolation and characterization of novel cyclotides from Viola hederaceae: solution structure and anti-HIV activity of vhl-1, a leaf-specific expressed cyclotide.
pubmed doi rcsb
molecule tags Antiviral protein
molecule keywords vhl-1
ec nomenclature
pdb deposition date 2005-04-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling
Application loaded.