2FG7C

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 174-239 66 1-173, 240-320 173 81 knot
Chain Sequence
SHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 174-239 66 1-173, 240-320 173 81 knot
view details
2.1 170-236 67 1-169 242-320 237-241 169 79 slipknot
view details
3.1 175-260 86 1-173, 276-320 174-174, 261-275 173 45 slipknot
view details
2.1 175-275 101 1-173, 290-320 174-174, 276-289 173 31 slipknot
view details
2.1 175-291 117 1-173, 298-320 174-174, 292-297 173 23 slipknot
sequence length 320
structure length 320
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
total genus Genus: 118
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21
KnotProt deposition date 2014-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
C PF02729.16 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
C PF00185.19 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg7C02
3L04A 3M5DA 3M4NA 3KZKA 3L02A 1YH1A 2FG7X 2G7MC 3KZMA 2FG7C 3KZOA 1JS1X 3M4JA 2FG6C 3KZNA 3KZCA 3M5CA 3L05A 3L06A
chains in the KnotProt database with same CATH superfamily
1E2HA 1E2LA 1R4NB 3VTKA 4IVQA 3L04A 3M5DA 1P73A 3M4NA 1KIMA 1KI3A 4IVRA 3KZKA 3RDPA 3L02A 1YH1A 2FG7X 1E2KA 1E2PA 1DBIA 2G7MC 1KI2A 1KI6A 1OSNA 3FR8A 1QHIA 2KI5A 3KZMA 2FG7C 1KI6B 1II9A 3FR7A 2XTJA 1QMGA 1E2IA 3KZOA 1JS1X 3M4JA 2FG6C 1P75A 4JBYA 3KZNA 1R4MB 1LNSA 4IVPA 1YRLA 2VTKA 1OF1A 1P72A 1KI4A 1KI8A 1KI7A 1E2MA 3KZCA 3M5CA 1P6XA 1E2NA 4JBXA 1F48A 3L05A 1YVEI 1E2JA 3F0TA 3FSGA 1VTKA 1P7CA 3L06A 1GKUB
chains in the KnotProt database with same CATH topology
3L04A 3M5DA 3M4NA 3KZKA 3L02A 1YH1A 2FG7X 1DBIA 2G7MC 3KZMA 2FG7C 2XTJA 3KZOA 1JS1X 3M4JA 2FG6C 3KZNA 1LNSA 3KZCA 3M5CA 3L05A 3FSGA 3L06A 1GKUB
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3L04 A;  3M5D A;  3M4N A;  3KZK A;  3L02 A;  1YH1 A;  2FG7 X;  2G7M C;  3KZM A;  2FG7 C;  3KZO A;  1JS1 X;  3M4J A;  2FG6 C;  3KZN A;  3KZC A;  3M5C A;  3L05 A;  3L06 A; 
#chains in the KnotProt database with same CATH topology
 1E2H A;  1E2L A;  1R4N B;  3VTK A;  4IVQ A;  3L04 A;  3M5D A;  1P73 A;  3M4N A;  1KIM A;  1KI3 A;  4IVR A;  3KZK A;  3RDP A;  3L02 A;  1YH1 A;  2FG7 X;  1E2K A;  1E2P A;  1DBI A;  2G7M C;  1KI2 A;  1KI6 A;  1OSN A;  3FR8 A;  1QHI A;  2KI5 A;  3KZM A;  2FG7 C;  1KI6 B;  1II9 A;  3FR7 A;  2XTJ A;  1QMG A;  1E2I A;  3KZO A;  1JS1 X;  3M4J A;  2FG6 C;  1P75 A;  4JBY A;  3KZN A;  1R4M B;  1LNS A;  4IVP A;  1YRL A;  2VTK A;  1OF1 A;  1P72 A;  1KI4 A;  1KI8 A;  1KI7 A;  1E2M A;  3KZC A;  3M5C A;  1P6X A;  1E2N A;  4JBX A;  1F48 A;  3L05 A;  1YVE I;  1E2J A;  3F0T A;  3FSG A;  1VTK A;  1P7C A;  3L06 A;  1GKU B; 
#chains in the KnotProt database with same CATH homology
 3L04 A;  3M5D A;  3M4N A;  3KZK A;  3L02 A;  1YH1 A;  2FG7 X;  1DBI A;  2G7M C;  3KZM A;  2FG7 C;  2XTJ A;  3KZO A;  1JS1 X;  3M4J A;  2FG6 C;  3KZN A;  1LNS A;  3KZC A;  3M5C A;  3L05 A;  3FSG A;  3L06 A;  1GKU B; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling