2FG7X

N-succinyl-l-ornithine transcarbamylase from b. fragilis complexed with carbamoyl phosphate and n-succinyl-l-norvaline
Knot K +31
Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
+31 174-240 67 1-173, 241-321 173 81 knot
Chain Sequence
GSHMKKFTCVQDIGDLKSALAESFEIKKDRFKYVELGRNKTLLMIFFNSSLRTRLSTQKAALNLGMNVIVLDINQGAWKLETERGVIMDGDKPEHLLEAIPVMGCYCDIIGVRSFARFENREYDYNEVIINQFIQHSGRPVFSMEAATRHPLQSFADLITIEEYKKTARPKVVMTWAPHPRPLPQAVPNSFAEWMNATDYEFVITHPEGYELDPKFVGNARVEYDQMKAFEGADFIYAKNWAAYLGDNYGQILSTDRNWTVGDRQMAVTNNAYFMHCLPVRRNMIVTDDVIESPQSIVIPEAANREISATVVLKRLLENLP
Whole chain analysis
Subchain analysis 

Knotoid cutoff: 0.5


Knotoid matrix content: 1

Knot core range Knot core length Knot tails range Slipknot tails range Slipknot loops range N-end length C-end length Type
view details
3.1 175-240 66 1-174, 241-321 174 81 knot
view details
2.1 171-237 67 1-170 245-321 238-244 170 77 slipknot
view details
2.1 176-269 94 1-174, 275-321 175-175, 270-274 174 47 slipknot
view details
3.1 176-286 111 1-174, 295-321 175-175, 287-294 174 27 slipknot
view details
2.1 176-295 120 1-174, 298-321 175-175, 296-297 174 24 slipknot
view details
2.1 176-297 122 1-174, 300-321 175-175, 298-299 174 22 slipknot
view details
2.1 176-299 124 1-174, 303-321 175-175, 300-302 174 19 slipknot
sequence length 321
structure length 321
publication title Structure and catalytic mechanism of a novel N-succinyl-L-ornithine transcarbamylase in arginine biosynthesis of Bacteroides fragilis.
pubmed doi rcsb
molecule tags Transferase
molecule keywords putative ornithine carbamoyltransferase
source organism Bacteroides fragilis
ec nomenclature ec 2.1.3.-:
pdb deposition date 2005-12-21
KnotProt deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
X PF02729.16 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain
X PF00185.19 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg7X02
3.40.50.1370 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2fg7X01
3KZNA 1YH1A 3L05A 2FG7C 3KZMA 1JS1X 3L04A 3M4JA 2FG6C 2FG7X 3KZKA 3L06A 3KZOA 3KZCA 3M5CA 2G7MC 3L02A 3M5DA 3M4NA
chains in the KnotProt database with same CATH superfamily
1QMGA 2XTJA 1E2MA 4JBYA 1E2JA 3KZNA 4IVQA 1YH1A 3F0TA 1DBIA 1E2PA 1P73A 1P75A 3L05A 1R4NB 2FG7C 3RDPA 1E2NA 1VTKA 3FR7A 3VTKA 1GKUB 1F48A 3KZMA 4IVRA 1JS1X 1QHIA 3FSGA 2VTKA 1KI4A 3L04A 3M4JA 1KI8A 1OF1A 1YRLA 2FG6C 1KI6B 1II9A 2FG7X 3KZKA 3L06A 3KZOA 1P7CA 2KI5A 3KZCA 1E2LA 1E2HA 1P6XA 1LNSA 1E2KA 4IVPA 3M5CA 3FR8A 1KI3A 1YVEI 2G7MC 1E2IA 1KI7A 1KIMA 3L02A 3M5DA 3M4NA 1OSNA 4JBXA 1P72A 1R4MB 1KI2A 1KI6A
chains in the KnotProt database with same CATH topology
2XTJA 3KZNA 1YH1A 1DBIA 3L05A 2FG7C 1GKUB 3KZMA 1JS1X 3FSGA 3L04A 3M4JA 2FG6C 2FG7X 3KZKA 3L06A 3KZOA 3KZCA 3M5CA 2G7MC 3L02A 3M5DA 3M4NA 1LNSA
chains in the KnotProt database with same CATH homology


 
#chains in the KnotProt database with same CATH superfamily
 3KZN A;  1YH1 A;  3L05 A;  2FG7 C;  3KZM A;  1JS1 X;  3L04 A;  3M4J A;  2FG6 C;  2FG7 X;  3KZK A;  3L06 A;  3KZO A;  3KZC A;  3M5C A;  2G7M C;  3L02 A;  3M5D A;  3M4N A; 
#chains in the KnotProt database with same CATH topology
 1QMG A;  2XTJ A;  1E2M A;  4JBY A;  1E2J A;  3KZN A;  4IVQ A;  1YH1 A;  3F0T A;  1DBI A;  1E2P A;  1P73 A;  1P75 A;  3L05 A;  1R4N B;  2FG7 C;  3RDP A;  1E2N A;  1VTK A;  3FR7 A;  3VTK A;  1GKU B;  1F48 A;  3KZM A;  4IVR A;  1JS1 X;  1QHI A;  3FSG A;  2VTK A;  1KI4 A;  3L04 A;  3M4J A;  1KI8 A;  1OF1 A;  1YRL A;  2FG6 C;  1KI6 B;  1II9 A;  2FG7 X;  3KZK A;  3L06 A;  3KZO A;  1P7C A;  2KI5 A;  3KZC A;  1E2L A;  1E2H A;  1P6X A;  1LNS A;  1E2K A;  4IVP A;  3M5C A;  3FR8 A;  1KI3 A;  1YVE I;  2G7M C;  1E2I A;  1KI7 A;  1KIM A;  3L02 A;  3M5D A;  3M4N A;  1OSN A;  4JBX A;  1P72 A;  1R4M B;  1KI2 A;  1KI6 A; 
#chains in the KnotProt database with same CATH homology
 2XTJ A;  3KZN A;  1YH1 A;  1DBI A;  3L05 A;  2FG7 C;  1GKU B;  3KZM A;  1JS1 X;  3FSG A;  3L04 A;  3M4J A;  2FG6 C;  2FG7 X;  3KZK A;  3L06 A;  3KZO A;  3KZC A;  3M5C A;  2G7M C;  3L02 A;  3M5D A;  3M4N A;  1LNS A; 
...loading similar chains, please wait...
similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the KnotProt database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

KnotProt | Interdisciplinary Laboratory of Biological Systems Modelling