| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 13-c-29-b-53-c-37 | 11-b-37 |
Chain Sequence |
GPLGSDTKLYCICKTPYDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDA
|
| sequence length |
62
|
| structure length |
62
|
| publication title |
Molecular basis for site-specific read-out of histone H3K4me3 by the BPTF PHD finger of NURF.
pubmed doi rcsb |
| molecule tags |
Protein binding
|
| molecule keywords |
bromodomain PHD finger transcription factor
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2006-01-27 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Herpes Virus-1 | Zinc/RING finger domain, C3HC4 (zinc finger) |
#chains in the KnotProt database with same CATH superfamily 2FUU A; #chains in the KnotProt database with same CATH topology 2FUU A; #chains in the KnotProt database with same CATH homology 2FUU A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
