
Jmol._Canvas2D (Jmol) "jmolApplet0"[x]
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
+31 | 3-77 | 75 | 1-2 | 102-109 | 78-101 | 2 | 8 | slipknot |
Chain Sequence |
MLYILNSAILPLKPGEEYTVKAKEITIQEAKELVTKEQFTSAIGHQATAELLSSILGVNVPMNRVQIKVTHGDRILAFMLKQRLPEGVVVKTTEELEKIGYELWLFEIQ
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
view details |
![]() |
3.1 | 3-82 | 80 | 1-2 | 88-109 | 83-87 | 2 | 22 | slipknot | ||
view details |
![]() |
3.1 | 2-92 | 91 | 1-1 | 102-109 | 93-101 | 1 | 8 | slipknot |
sequence length |
109
|
structure length |
109
|
publication title |
Crystal Structure of Afv3-109, a Highly Conserved Protein from Crenarchaeal Viruses.
pubmed doi rcsb |
molecule tags |
Viral protein
|
molecule keywords |
AFV3-109
|
source organism |
Acidianus filamentous virus 1
|
total genus |
![]() |
ec nomenclature | |
pdb deposition date | 2006-09-27 |
KnotProt deposition date | 2014-07-31 |
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...