| Loop | Piercing | ||||
|---|---|---|---|---|---|
| view details | 56-c-70-b-124-c-110 | 81-b-141 |
Chain Sequence |
GWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
|
| sequence length |
189
|
| structure length |
189
|
| publication title |
Characterization of the Structural Features and Interactions of Sclerostin: Molecular insight into a key regulator of Wnt-mediated bone formation
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| molecule keywords |
Sclerostin
|
| source organism |
Homo sapiens
|
| ec nomenclature | |
| pdb deposition date | 2008-09-18 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
