Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 16-c-22-b-46-c-46 | 16-b-36 |
Chain Sequence |
VRDAYIAKPENCVYECGITQDCNKLCTENGAESGYCQWGGKYGNACWCIKLPDSVPIRVPGKCQ
|
sequence length |
64
|
structure length |
64
|
publication title |
Solution Structure of BmK-M10
rcsb |
molecule tags |
Toxin
|
molecule keywords |
Neurotoxin BmK-M10
|
ec nomenclature | |
pdb deposition date | 2008-11-28 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 2-Layer Sandwich | Defensin A-like | Defensin A-like |
#chains in the KnotProt database with same CATH superfamily 1PX9 A; 2KBH A; 1N4N A; 1NH5 A; 2KBK A; #chains in the KnotProt database with same CATH topology 1PX9 A; 2KBH A; 1N4N A; 1NH5 A; 2KBK A; #chains in the KnotProt database with same CATH homology 1PX9 A; 2KBH A; 1N4N A; 1NH5 A; 2KBK A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...