Loop | Piercing | ||||
---|---|---|---|---|---|
view details | 93-c-100-b-114-c-108 | 107-b-125 |
Chain Sequence |
CVATRNSCKPAAAACCDPCASCYCRFFRSACYCRVLSLNC
|
sequence length |
40
|
structure length |
40
|
publication title |
Loop-swapped chimeras of the agouti-related protein and the agouti signaling protein identify contacts required for melanocortin 1 receptor selectivity and antagonism.
pubmed doi rcsb |
molecule tags |
Signaling protein
|
molecule keywords |
Agouti-signaling protein
|
ec nomenclature | |
pdb deposition date | 2010-06-14 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Agouti Related Protein; Chain A | Agouti Related Protein; Chain A |
#chains in the KnotProt database with same CATH superfamily 1Y7K A; 1Y7J A; 2KZA A; #chains in the KnotProt database with same CATH topology 1Y7K A; 1Y7J A; 2KZA A; #chains in the KnotProt database with same CATH homology 1Y7K A; 1Y7J A; 2KZA A;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...