| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
+31 | 13-69 | 57 | 1-12 | 155-159 | 70-154 | 12 | 5 | slipknot |
Chain Sequence |
PLHAYFKLPNTVSLVAGSSEGETPLNAFDGALLNAGIGNVALIRISSIMPPEAEIVPLPKLPMGALVPTAYGYIISDVPGETISAAISVAIPKDKSLCGLIMEYEGKCSKKEAEKTVREMAKIGFEMRGWELDRIESIAVEHTVEKLGCAFAAAALWYK
|
Knotoid cutoff: 0.5
Knotoid matrix content: 1
| Knot core range | Knot core length | Knot tails range | Slipknot tails range | Slipknot loops range | N-end length | C-end length | Type | |||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| view details |
 |
3.1 | 12-70 | 59 | 1-11 | 154-159 | 71-153 | 11 | 6 | slipknot |
| sequence length |
159
|
| structure length |
159
|
| publication title |
Structures of the N47A and E109Q mutant proteins of pyruvoyl-dependent arginine decarboxylase from Methanococcus jannaschii.
pubmed doi rcsb |
| molecule tags |
Lyase
|
| molecule keywords |
Pyruvoyl-dependent arginine decarboxylase (EC 4.1.1.19) (Pvl
|
| source organism |
Methanocaldococcus jannaschii
|
| total genus |
 Genus: 44
|
| ec nomenclature |
ec
4.1.1.19: Arginine decarboxylase. |
| pdb deposition date | 2007-07-26 |
| KnotProt deposition date | 2014-10-11 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| C | PF01862 | PvlArgDC | Pyruvoyl-dependent arginine decarboxylase (PvlArgDC) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(bba) Sandwich | Pyruvoyl-Dependent Histidine Decarboxylase; Chain B | Pyruvoyl-Dependent Histidine Decarboxylase, subunit B |
#chains in the KnotProt database with same CATH superfamily 1N2M A; 2QQD C; #chains in the KnotProt database with same CATH topology 1N2M A; 2QQD C; #chains in the KnotProt database with same CATH homology 1N2M A; 2QQD C;
#similar chains in the KnotProt database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
